Cart
sales@molnova.com
Home - Products - Others - Other Targets - Ertugliflozin L-pyroglutamic acid

Ertugliflozin L-pyroglutamic acid

CAS No. 1210344-83-4

Ertugliflozin L-pyroglutamic acid ( PF-04971729 L-pyroglutamic acid )

Catalog No. M26680 CAS No. 1210344-83-4

Ertugliflozin L-pyroglutamic acid is a selective and orally active hSGLT2 inhibitor with an IC50 of 0.877 nM.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 35 In Stock
10MG 50 In Stock
25MG 74 In Stock
50MG 87 In Stock
100MG 129 In Stock
200MG 188 In Stock
500MG 322 In Stock
1G Get Quote In Stock
Group Booking Get Quotation Bulk Inquiry Add to Cart

Biological Information

  • Product Name
    Ertugliflozin L-pyroglutamic acid
  • Note
    Research use only, not for human use.
  • Brief Description
    Ertugliflozin L-pyroglutamic acid is a selective and orally active hSGLT2 inhibitor with an IC50 of 0.877 nM.
  • Description
    Ertugliflozin L-pyroglutamic acid is a selective and orally active hSGLT2 inhibitor with an IC50 of 0.877 nM. Ertugliflozin L-pyroglutamic acid can be used for studies about the treatment of type 2 diabetes mellitus.(In Vitro):Ertugliflozin L-pyroglutamic acid demonstrated >2000-fold selectivity for SGLT2 over SGLT.(In Vivo):The oral administration of Ertugliflozin L-pyroglutamic to rats acid showed concentration-dependent glucosuria.
  • Synonyms
    PF-04971729 L-pyroglutamic acid
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Caspase-3
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    1210344-83-4
  • Formula Weight
    566.0
  • Molecular Formula
    C27H32ClNO10
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    OC(=O)[C@@H]1CCC(=O)N1.CCOc1ccc(Cc2cc(ccc2Cl)[C@]23OC[C@](CO)(O2)[C@@H](O)[C@H](O)[C@H]3O)cc1
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Kravchenko DV, et al. Synthesis and structure-activity relationship of 4-substituted 2-(2-acetyloxyethyl)-8-(morpholine-4-sulfonyl)pyrrolo[3,4-c]quinoline-1,3-diones as potent caspase-3 inhibitors. J Med Chem. 2005 Jun 2;48(11):3680-3.
Calculator

Molecular Weight Calculator

Dilution Calculator

Molarity Calculator

molnova catalog
related products

  • 1-Undecanol

    1-Undecanol is a natural product in many foods such as fruits butter eggs and cooked pork is used as a flavoring ingredient.?

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • CCP peptide

    CCP peptide is a synthetic cyclic peptide incorporating the amino acid citrulline.

Sign In Join Free